Human beta Defensin-2 Recombinant

Human beta Defensin-2 Recombinant
Artikelnummer
BPS90107-B
Verpackungseinheit
20 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Amino Acid Sequence: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Background: Defensins are a large family of peptides of which two groups exist in mammals: alpha defensins and beta defensins, which are distinguishable by the spacing and connectivity of the conserved cysteine residues within the mature peptides. It is thought that defensins function in the eradication of pathogens from the host system by inserting themselves into the bacterial membrane under the influence of membrane potential, forming channels which lead to leakage of cytoplasmic molecules and cell death. Unlike hBD-1, this second peptide, human beta-defensin-2 (hBD-2), is regulated at a transcriptional level in response to contact with microorganisms, and is highly effective in killing Gram negative bacteria. Its expression is also upregulated by the cytokine tumor necrosis factor-alpha.

Biological Activity: The ED50 was determined by its ability to chemoattract immature human dendritic cells using a concentration range of 1-50 ng/ml.

Description: Recombinant beta Defensin-2 is a disulfide-linked monomer protein consisting of 42 amino acid residues, and migrates as an approximately 4 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human beta Defensin-2 mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered 100 mM NaCl, 20 mM phosphate buffer, pH 7.4.

Genbank: O15263

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: O15263

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. J. Biol. Chem., Apr 2009, 284: 10034 - 10045.
2. J. Immunol., Feb 2009, 182: 1609 - 1616.
3. Endocrinology, Oct 2008, 149: 5189 - 5198.
Mehr Informationen
Artikelnummer BPS90107-B
Hersteller BPS Bioscience
Hersteller Artikelnummer 90107-B
Green Labware Nein
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×