Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 35-107
Amino Acid Sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Background: Growth regulated oncogene-gamma belongs to the family of chemotyctic cytokines called chemokines. It is identical with MGSA (melanoma growth stimulatory activity) and the new designation is CXCL3. This factor is known mainly because of its chemotactic activity. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively. Similar to other alpha chemokines, the three GRO proteins are potent neutrophil attractants and activators. In addition, these chemokines are also active toward basophils. All three GROs can bind with high affinity to the IL-8 receptor type B.
Biological Activity: Determined by its ability to chemoattract 293 transfected CXCR2 cells using a concentration range of 10-100 ng/ml.
Description: Recombinant GRO-gamma is a disulfide-linked homodimeric protein consisting of 74 amino acid residues, and migrates as an approximately 8 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding human GRO-gamma (CXCL3) mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from 0.2 µm filtered concentrated (1 mg/ml) solution in 100 mM NaCl, 20 mM phosphate buffer, pH 7.5.
Genbank: P19876
Purity: ≥95% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P19876
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Al-Alwan LA, et al. J Immunol. 2013 Sep 1,191(5):2731-41.
2. Adrogue HE, et al. Am J Nephrol. 2007,27(3):253-61.