Human HCC-4(CCL16) Recombinant

Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 24-120

Amino Acid Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Background: CCL16, also known as liver- expressed chemokine or NCC-4 or lymphocyte and monocyte chemoattractant or HCC-4, is a CC chemokine that specifically attracts lymphocytes, dendritic cells, and monocytes, it increases their adhesive properties and has myelosuppressive activity. CCL16 is constitutively expressed in liver and is increased by interleukin 10 (IL-10) in activated monocytes. CCL16 is present in human plasma suggesting that it may be active outside hepatic tissue. CCR1, CCR2, CCR5, and CCR8 are the functional receptors of this chemokine.

Biological Activity: Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0 ng/ml.

Description: Recombinant LEC/CCL16 is a disulfide-linked monomeric protein consisting of 98 amino acid residues and migrates as an approximately 11 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human LEC (CCL16) mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered solution in 100 mM NaCl, 20 mM phosphate buffer, pH 7.5.

Genbank: O15467

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: O15467

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. J. Leukoc. Biol., Jan 2004, 75: 135.
2. Blood, Jan 2004, 103: 40 - 49.

• Artikelnummer: BPS90154-A
• Hersteller: BPS Bioscience
• Hersteller Artikelnummer: 90154-A
• Verpackungseinheit: 5 µg
• Mengeneinheit: STK