Human Insulin Like Growth Factor-I Recombinant

Human Insulin Like Growth Factor-I Recombinant
Artikelnummer
BPS90166-A
Verpackungseinheit
20 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 49-118

Amino Acid Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Background: Insulin-like growth factor I, also known as somatomedin C, is the dominant effector of growth hormone and is structurally homologous to proinsulin. Human IGF-I is synthesized as two precursor isoforms with N- and alternate C- terminal propeptides. These isoforms are differentially expressed by various tissues. The 7.6 kDa mature IGF-I is identical between isoforms and is generated by proteolytic removal of the N- and C- terminal regions. Mature human IGF-I shares 94% and 96% a.a. sequence identity with mouse and rat IGF-I, respectively, and exhibits cross-species activity. It shares 64% aa sequence identity with mature human IGF-II. Circulating IGF-I is produced by hepatocytes, while local IGF-I is produced by many other tissues in which it has paracrine effects.

Biological Activity: The ED50 was determined by a cell proliferation assay using FDC-P1 cells is ≤ 1.0 ng/ml, corresponding to a specific activity of≥ 1 x 10^6 units/mg.

Description: Recombinant Human IGF-1 is a disulfide-linked monomeric protein consisting of 71 amino acid residues. IGF-1 migrates as an approximately 8 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human IGF-1 mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered PBS, pH 7.4.

Genbank: P01343

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P01343

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. J. Clin. Endocrinol. Metab. October 1, 2009. 94 (10): 3913-3921.
2. Mol. Biol. Cell, Sep 2009, 20: 3810 - 3817.
3. Endocrinology, Sep 2009, 150: 4395 - 4403.
Mehr Informationen
Artikelnummer BPS90166-A
Hersteller BPS Bioscience
Hersteller Artikelnummer 90166-A
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×