Human Insulin Recombinant

Human Insulin Recombinant
Artikelnummer
BPS90202-B
Verpackungseinheit
250 mg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 25-54, 90-110

Amino Acid Sequence: GIVEQCCTSICSLYQLENYCN (chain a) and FVNQHLCGSHLVEALYLVCGERGFFYTPKT (chain b)

Background: Native human Insulin is generated by the proteolytic removal of the signal peptide and propeptide, and has a calculated molecular mass of approximately 6 kDa

Biological Activity: 30 IU/mg

Description: Recombinant human Insulin is a disulfide-linked homodimeric protein consisting of 51 amino acid residues, and migrates as an approximately 6 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Insulin mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered aqueous solution with no additives

Genbank: P01308

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P01308

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Ikeya, T., et al., Proc R Soc B. Nov 2009,276:3799-3807.
2. Smith, R., et al., Hum. Mol. Genet., Oct 2009,18:3942-3954.
3. Liu, H., et al., J Biol Chem., Oct 2009,284:27090-27100
Mehr Informationen
Artikelnummer BPS90202-B
Hersteller BPS Bioscience
Hersteller Artikelnummer 90202-B
Verpackungseinheit 250 mg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×