English
Human Interleukin-1 receptor antagonist Recombinant
Human Interleukin-1 receptor antagonist Recombinant
Artikelnummer
BPS90170-A
Verpackungseinheit
20 µg
Hersteller
BPS Bioscience
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 26-177
Amino Acid Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Background: IL1ra is found in the conditioned medium of a variety of cells and is produced by macrophages, monocytes,neutrophils. The soluble form of IL1ra has been shown to be produced by hepatocytes, and to be regulated by pro- inflammatory cytokines.
Biological Activity: The ED50 as determined by the ability to inhibit the IL-1α mediated cell proliferation in a murine helper T cell line in the presence of 50 pg/mL of IL-1α, is typically 20 - 60 ng/mL.
Description: Recombinant IL-1RA is a disulfide-linked monomer protein consisting of 153 amino acid residues, and migrates as an approximately 17 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human interleukin-1 receptor antagonist mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from 0.2 µm filtered PBS, pH 7.4.
Genbank: P18510
Purity: ≥95% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P18510
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Diabetes Care, Sep 2009, 32: 1663 - 1668.
2. N. Engl. J. Med., Jun 2009, 360: 2426 - 2437.
3. Endocrinology, Jun 2009, 150: 2660 - 2667.
Encompassing Amino Acids: 26-177
Amino Acid Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Background: IL1ra is found in the conditioned medium of a variety of cells and is produced by macrophages, monocytes,neutrophils. The soluble form of IL1ra has been shown to be produced by hepatocytes, and to be regulated by pro- inflammatory cytokines.
Biological Activity: The ED50 as determined by the ability to inhibit the IL-1α mediated cell proliferation in a murine helper T cell line in the presence of 50 pg/mL of IL-1α, is typically 20 - 60 ng/mL.
Description: Recombinant IL-1RA is a disulfide-linked monomer protein consisting of 153 amino acid residues, and migrates as an approximately 17 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human interleukin-1 receptor antagonist mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from 0.2 µm filtered PBS, pH 7.4.
Genbank: P18510
Purity: ≥95% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P18510
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Diabetes Care, Sep 2009, 32: 1663 - 1668.
2. N. Engl. J. Med., Jun 2009, 360: 2426 - 2437.
3. Endocrinology, Jun 2009, 150: 2660 - 2667.
| Artikelnummer | BPS90170-A |
|---|---|
| Hersteller | BPS Bioscience |
| Hersteller Artikelnummer | 90170-A |
| Verpackungseinheit | 20 µg |
| Mengeneinheit | STK |
| Produktinformation (PDF) |
|
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
