Human Interleukin-6 Recombinant

Human Interleukin-6 Recombinant
Artikelnummer
BPS90196-B
Verpackungseinheit
20 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 30-212

Amino Acid Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Background: IL-6 is a member of a family of cytokines, which also includes LIF, CNTF, Oncostatin M, IL11, and CT- 1. All known members of the IL-6 cytokine family induce hepatic expression of acute phase proteins. IL-6 is produced by many different cell types. The main sources in vivo are stimulated monocytes, fibroblasts, and endothelial cells. Macrophages, T-cells and B-lymphocytes, granulocytes, smooth muscle cells, eosinophils, chondrocytes, osteoblasts, mast cells, glial cells, and keratinocytes also produce IL-6 after stimulation. The IL-6 receptor is expressed on T-cells, mitogen-activated B-cells, peripheral monocytes and some macrophage- and B-cell derived tumor cell types. It is not expressed in resting B-cells but in resting T-cells. The IL-6 receptor (CD126) is a strongly glycosylated protein of 80 kDa and a length of 449 amino acids.

Biological Activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of murine 7TD1 cells to be less than 0.1 ng/ml, corresponding to specific activity of 1x10^7IU/mg.

Description: Recombinant human IL-6 is a glycosylated disulfide-linked homodimeric protein consisting of 184 amino acid residues, and migrates as an approximately 20 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Interleukin-6 mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered PBS solution, pH 7.0.

Genbank: P05231

Purity: ≥97% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P05231

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Am. J. Respir. Cell Mol. Biol., Oct 2009, 41: 385 - 396.
2. Ann Rheum Dis, Oct 2009, 68: 1580 - 1584.
3. Glycobiology, Oct 2009, 19: 1082 - 1093.
Mehr Informationen
Artikelnummer BPS90196-B
Hersteller BPS Bioscience
Hersteller Artikelnummer 90196-B
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×