Human MIG Recombinant

Human MIG Recombinant
Artikelnummer
BPS90216-A
Verpackungseinheit
5 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 23-125

Amino Acid Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Background: MIG (CXCL9) protein belongs to the family of chemotactic cytokines known as chemokines. The synthesis of MIG (CXCL9) is specifically induced in macrophages and in other cells by IFN-gamma. Human neutrophils produce MIG in response to IFN-gamma in combination with either TNF-alpha or bacterial lipopolysaccharides and this response is blocked by IL-10 and IL-4. MIG is a chemoattractant for stimulated but not resting T-cells, however it is not active on neutrophils or monocytes. MIG is thought to be involved in T cell trafficking.

Biological Activity: Determined by its ability to chemoattract human peripheral blood T lymphocytes using a concentration range of 10.0-80.0 ng/ml.

Description: Recombinant MIG (CXCL9) is a disulfide-linked monomeric protein consisting of 104 amino acid residues, migrates as an approximately 11 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human MIG mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered 1.0 mg/ml solution in 25 mM NaCl, 10 mM phosphate buffer, pH 7.0.

Genbank: Q07325

Purity: ≥97% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: Q07325

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Am. J. Pathol., Jun 2009, 174: 2172 - 2181.
2. J. Clin. Endocrinol. Metab., May 2009, 94: 1803 - 1809.
3. Invest. Ophthalmol. Vis. Sci., Apr 2009, 50: 1977.
Mehr Informationen
Artikelnummer BPS90216-A
Hersteller BPS Bioscience
Hersteller Artikelnummer 90216-A
Verpackungseinheit 5 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×