Human MIP4(CCL18) Recombinant

Human MIP4(CCL18) Recombinant
Artikelnummer
BPS90221-A
Verpackungseinheit
5 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 21-89

Amino Acid Sequence: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Background: CCL18, also designated dendritic cell (DC)3-derived CC chemokine 1, pulmonary and activation-regulated chemokine, alternative macrophage activation-associated CC chemokine 1, and MIP-4, is a human chemokine structurally related to CCL3. CCL18 was shown to be expressed in germinal centers of tonsils by dendritic cells and to attract mainly naive T cells, CD38, mantle zone B lymphocytes and DC. The production of CCL18 by APC is enhanced by Th2 cytokines like IL-4 and IL-13 and suppressed by IFN-gamma.

Biological Activity: Determined by its ability to chemoattract human T cells using a concentration range of 2.0-40.0 ng/ml.

Description: Recombinant CCL18 is a disulfide-linked homodimeric protein consisting of 70 amino acid residues and migrates as an approximately 16 kDa protein under non-reducing conditions and 8 kDa under reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human MIP-4 mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered 20 mM Phosphate buffer, 100 mM NaCl, pH 7.5.

Genbank: P55774

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P55774

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Chest, Feb 2009, 135: 295 - 302.br>2. J. Immunol., Jul 2008, 181: 1215 - 1223.
3. Ann Rheum Dis, Oct 2007, 66: 1334 - 1338.
Mehr Informationen
Artikelnummer BPS90221-A
Hersteller BPS Bioscience
Hersteller Artikelnummer 90221-A
Verpackungseinheit 5 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×