English
Human Neurotrophin-4 Recombinant
Human Neurotrophin-4 Recombinant
Artikelnummer
BPS90226-A
Verpackungseinheit
2 µg
Hersteller
BPS Bioscience
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€
Amino Acid Sequence: GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Background: Neurotrophins are well-known retrograde signaling molecules that regulate differentiation and cell survival in many central and peripheral neurons. Neurotrophin-4 (NT-4) is the most recently discovered neurotrophic factor in mammals and, functionally, the least well understood. Little is known about the role of NT-4 in supporting the survival of identified classes of sensory neurons. Mice lacking NT4 (NT4/) exhibit a loss of ~50% of the neurons in the nodose-petrosal and geniculate ganglia but no apparent loss of neurons in the dorsal root ganglia.
Biological Activity: The ED50 was determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures, and was found to be in a range of 10-50 ng/ml.
Description: Recombinant NT-4 is a disulfide-linked homodimer protein consisting of two 131 amino acid residues, and migrates as an approximately 29 kDa protein under non-reducing and as 14 kDa under reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neurotrophin-4 mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered PBS solution, pH 7.5.
Genbank: P34130
Purity: ≥97% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P34130
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. J. Biol. Chem., Feb 2008, 283: 3385 - 3391.
2. J. Pharmacol. Exp. Ther., Nov 2005, 315: 796 - 804.
Amino Acid Sequence: GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Background: Neurotrophins are well-known retrograde signaling molecules that regulate differentiation and cell survival in many central and peripheral neurons. Neurotrophin-4 (NT-4) is the most recently discovered neurotrophic factor in mammals and, functionally, the least well understood. Little is known about the role of NT-4 in supporting the survival of identified classes of sensory neurons. Mice lacking NT4 (NT4/) exhibit a loss of ~50% of the neurons in the nodose-petrosal and geniculate ganglia but no apparent loss of neurons in the dorsal root ganglia.
Biological Activity: The ED50 was determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures, and was found to be in a range of 10-50 ng/ml.
Description: Recombinant NT-4 is a disulfide-linked homodimer protein consisting of two 131 amino acid residues, and migrates as an approximately 29 kDa protein under non-reducing and as 14 kDa under reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neurotrophin-4 mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered PBS solution, pH 7.5.
Genbank: P34130
Purity: ≥97% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P34130
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. J. Biol. Chem., Feb 2008, 283: 3385 - 3391.
2. J. Pharmacol. Exp. Ther., Nov 2005, 315: 796 - 804.
| Artikelnummer | BPS90226-A |
|---|---|
| Hersteller | BPS Bioscience |
| Hersteller Artikelnummer | 90226-A |
| Green Labware | Nein |
| Verpackungseinheit | 2 µg |
| Mengeneinheit | STK |
| Produktinformation (PDF) |
|
| MSDS (PDF) |
|
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
