Human Oncostatin M Recombinant

Human Oncostatin M Recombinant
Artikelnummer
BPS90227-A
Verpackungseinheit
2 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Amino Acid Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR

Background: Oncostatin M is produced by monocytes and T-cells after cell activation, adherent macrophages, and various T- cell lines. Oncostatin M is a member of the IL-6-related cytokine subfamily that includes IL-6, IL-11, LIF, CNTF and CT-1. Oncostatin M mediates its bioactivities through two different heterodimer receptors. They both involve gp130 as a signal transducing moiety, which is found also in receptors for a number of other cytokines. When gp130 dimerizes with LIF receptor beta subunit this generates the high affinity type 1 OSM receptor. When gp130 dimerizes with a protein known as OSM receptor beta this generates the type 2 OSM receptor. Both OSM receptors activate the receptor-associated Janus kinases JAK1, JAK2, and TYK2. Signaling also involves the transcriptional activators STAT3 and STAT5b. was specifically activated through the gp130-OSM-R-beta type II heterocomplex. The signaling pathway differences observed between the common type I LIF/OSM receptor and the specific type II OSM receptor might explain some of the bioactivities specifically displayed by OSM. Oncostatin M inhibits the growth of several tumor cell lines (A375 melanoma, lung carcinomas). The antiproliferative activity of oncostatin M for some cell lines is synergised by TGF-beta and IFN-gamma. It promotes the growth of human fibroblasts, vascular smooth muscle cells, and some normal cell lines. Oncostatin can inhibit the proliferation of murine M1 myeloid leukemic cells and induces their differentiation into macrophage-like cells, a function shared by LIF, G-CSF, and IL-6.

Biological Activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of f human TF-1 cells is ≤ 3 ng/ml, corresponding to a specific activity of≥ 2 x 10^5 units/mg.

Description: Recombinant Oncostatin-M is a disulfide-linked homodimeric protein consisting of 228 amino acid residues, and migrates as an approximately 26 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Oncostatin-M mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered concentrated (1 mg/ml) PBS solution, pH 7.0.

Genbank: P13725

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P13725

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Am. J. Respir. Cell Mol. Biol., May 2009, 40: 620 - 630.
2. J. Virol., Apr 2009, 83: 3298 - 3311.
3. Clin. Cancer Res., Mar 2009, 15: 1519 - 1526.
Mehr Informationen
Artikelnummer BPS90227-A
Hersteller BPS Bioscience
Hersteller Artikelnummer 90227-A
Green Labware Nein
Verpackungseinheit 2 µg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF)
×