Human PEDF Recombinant

Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 20-418

Amino Acid Sequence: QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Background: Pigment epithelium-derived factor (PEDF), a 50- kDa secreted glycoprotein, is widely expressed throughout the human body, with expression decreasing during human hepatocellular carcinoma and breast cancer progression. PEDF binds to a cell membrane receptor to exhibit multifunctional activity in many cell types but its signaling mechanisms are largely unknown. PEDF exerts anti-angiogenic activity by arresting VEGF- or bFGF-mediated endothelial cell migration, inhibiting capillary morphogenesis, and inducing endothelial cell apoptosis. In human dermal microvascular cells, PEDF induces FasL expression and subsequently activation of caspase-8, which initiates the downstream apoptotic cascade. In human umbilical vein endothelial cells (HUVECs), its induction of apoptosis was shown to depend on p38 MAPK activity and to involve activation of caspases-8 and -9.

Description: Recombinant human pigment epithelium-derived factor (PEDF) is a disulfide-linked monomer protein consisting of 440 amino acid residue subunits, and migrates as an approximately 45k Da protein under non-reducing and reducing conditions in SDS-PAGE. Source: Optimized DNA sequence encoding human PEDF mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered 20 mM phosphate buffer, 150 mM NaCl solution, pH 7.5.

Genbank: P36955

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P36955

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Craword SE, et al. Expert Opin Drug Discov. 2013 Jul,8(7):769-92.
2. Alcantara MB, Dass CR. Cell Physiol Biochem. 2013,31(4-5):487-94.
3. Becerra SP, Notario V. Nat Rev Cancer. 2013 Apr,13(4):258-71.

• Artikelnummer: BPS90229-A
• Hersteller: BPS Bioscience
• Hersteller Artikelnummer: 90229-A
• Verpackungseinheit: 2 µg
• Mengeneinheit: STK