Human Platelet Derived Growth Factor-AA Recombinant

Human Platelet Derived Growth Factor-AA Recombinant
Artikelnummer
BPS90228-B
Verpackungseinheit
10 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 87-211

Amino Acid Sequence: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Background: PDGF is synthesized mainly by megakaryocytes. It is stored in the alpha granules of platelets from which it is released after cell activation of platelets. Platelets synthesize a mixture of the three possible isoforms (BB, AB, AA) while fibroblasts stimulated with EGF synthesize AA homodimers. PDGF receptors are expressed in fibroblasts, osteoblasts, chondroblasts, smooth muscle cells, glial cells, and endothelial cells. Two related receptors, are PDGFRalpha (CD140a) or PDGFRbeta ( CD140b). In contrast to many other cytokines PDGF is not released into the circulation. PDGF binds to several plasma proteins and also to proteins of the extracellular matrix which facilitates local concentration of the factor. The factor functions as a local autocrine and paracrine growth factor. In the adult organism PDGF is involved in wound healing processes. The aberrant expression of PDGF is observed with vascular proliferative diseases such as atherosclerosis. PDGF regulates the synthesis of its own receptor and also influences the expression of membrane receptors for IL-1, EGF, 5-Hydroxytryptamine, LDL, transferrin, and muscarinergic receptor.

Biological Activity: The ED50 was determined by the dose-dependent stimulation of thymidine uptake by Balb/c 3T3 cells is ≤ 1 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg

Description: Recombinant PDGF-AA is a disulfide-linked homodimeric protein consisting of two 126 amino acid residues, migrates as an approximately 28 kDa protein under non-reducing and as 14 kDa under reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human PDGF-AA mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered PBS solution, pH 7.0.

Genbank: P04085

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P01127

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Am J Physiol Renal Physiol, Feb 2009, 296: F406 - F417.
2. Nephrol. Dial. Transplant., Apr 2005, 20: 790 - 796.
3. J. Cell Sci., Mar 1999, 112: 905 - 915.
Mehr Informationen
Artikelnummer BPS90228-B
Hersteller BPS Bioscience
Hersteller Artikelnummer 90228-B
Verpackungseinheit 10 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×