English
Cpn10 Protein
Human Recombinant Cpn10 Protein
Artikelnummer
STRSPR-310A
Verpackungseinheit
50 µg
Hersteller
Stressmarq Biosciences
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Target: Cpn10 .
Nature: Recombinant.
Swiss-Prot: P61604.
Expression System: E. coli.
Amino Acid Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD.
Purification: Multi-Step Purified.
Purity: >90%.
Storage Buffer: 20mM Tris, pH7.5, 0.3M NaCl, 10% glycerol, 1 mM DTT.
Protein Size: ~10 kDa.
Conjugate: No tag.
Cellular Localization: Mitochondrion Matrix.
Scientific Background: Chaperonin 10, otherwise known as Cpn10, (groES in E.coli) make up a family of small heart shock proteins with an approximate molecular mass of 10kDa (HSP10s). Cpn10 acts as a co-chaperone and interacts with the HSP60 family to promote proper folding of polypeptides. Cpn10 and Cpn60 both exhibit sevenfold axis of symmetry and function as a team in the protein folding and assembly process (1). Cpn10 has been located in human platelets, but is also present in human maternal serum (2, 3). It has been reported that human Cpn10 is identical with early pregnancy factor, which is involved in control over cell growth and development. This identification suggest that Cpn10 may act like a hormone in stressful situations such as pregnancy (4).
References: 1. Velez-Granell C.S., et al. (1994) J of Cell Science. 107(3):539-549.2. Morton H., Hegh V., and Clunie G.J.A. (1974) Nature (London) 249: 459-460.3. Cavanagh A.C., and Morton H. (1994) Eur. J. Biochem. 222: 551-560.4. Minto M., et al. (1998) Molecular Cell Research. 1403 (2): 151-157.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Nature: Recombinant.
Swiss-Prot: P61604.
Expression System: E. coli.
Amino Acid Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD.
Purification: Multi-Step Purified.
Purity: >90%.
Storage Buffer: 20mM Tris, pH7.5, 0.3M NaCl, 10% glycerol, 1 mM DTT.
Protein Size: ~10 kDa.
Conjugate: No tag.
Cellular Localization: Mitochondrion Matrix.
Scientific Background: Chaperonin 10, otherwise known as Cpn10, (groES in E.coli) make up a family of small heart shock proteins with an approximate molecular mass of 10kDa (HSP10s). Cpn10 acts as a co-chaperone and interacts with the HSP60 family to promote proper folding of polypeptides. Cpn10 and Cpn60 both exhibit sevenfold axis of symmetry and function as a team in the protein folding and assembly process (1). Cpn10 has been located in human platelets, but is also present in human maternal serum (2, 3). It has been reported that human Cpn10 is identical with early pregnancy factor, which is involved in control over cell growth and development. This identification suggest that Cpn10 may act like a hormone in stressful situations such as pregnancy (4).
References: 1. Velez-Granell C.S., et al. (1994) J of Cell Science. 107(3):539-549.2. Morton H., Hegh V., and Clunie G.J.A. (1974) Nature (London) 249: 459-460.3. Cavanagh A.C., and Morton H. (1994) Eur. J. Biochem. 222: 551-560.4. Minto M., et al. (1998) Molecular Cell Research. 1403 (2): 151-157.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
| Artikelnummer | STRSPR-310A |
|---|---|
| Hersteller | Stressmarq Biosciences |
| Hersteller Artikelnummer | SPR-310A |
| Green Labware | Nein |
| Verpackungseinheit | 50 µg |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Methode | Western Blotting, SDS-PAGE |
| Human Gene ID | 3336 |
| Produktinformation (PDF) | Download |
| MSDS (PDF) | Download |
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
