Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 17-108
Amino Acid Sequence: SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Background: Resistin was identified by screening for genes that are induced during the differentiation of adipocytes but down-regulated in mature adipocytes. Resistin gene expression is induced during the differentiation of adipocytes. Resistin circulates in mouse serum, and its level is increased markedly in obesity. Adipocytes secrete resistin as a unique signaling molecule that may be the hormone potentially linking obesity to type II diabetes, which is characterized by target-tissue resistance to insulin. TNF-alpha is a negative regulator of Resistin gene expression and inhibits Resistin mRNA expression and protein secretion by 70-90% in 3T3-L1 adipocytes.
Biological Activity: Determined by its ability to stimulate lipolysis in cultured human adipocytes.
Description: Recombinant Resistin is a disulfide-linked homodimeric protein consisting of two 93 amino acid residues, and migrates as an approximately 20 kDa protein under non-reducing conditions and as a 10 kDa protein under reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Resistin mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered PBS solution.
Genbank: Q9HD89
Purity: ≥95% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: Q9HD89
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Al-Suhaimi EA, Shehzad A. Eur J Med Res. 2013 May 1,18:12.
2. Lee SE, Kim HS. J Smooth Muscle Res. 2012,48(1):27-35.
3. Tiaka EK, et al. Cytokine Growth Factor Rev. 2011 Apr,22(2):109-19.