Products from BPS Bioscience require a minimum order value above 400€
Amino Acid Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Background: SDF-1alpha and SDF-1beta are small cytokines belonging to the CXC- Chemokines. SDF-1 is identical with a chemokine reported to function as a pre-B-cell growth factor in the presence of IL-7 and isolated originally from a murine bone marrow stromal cell line. Human SDF-1alpha and SDF-1beta are encoded by a single gene and arise by alternative splicing. SDF-1 acts on lymphocytes and monocytes but not neutrophils in vitro and is a highly potent chemoattractant for mononuclear cells in vivo. In addition, SDF-1 also induces intracellular actin polymerization in lymphocytes. SDF acts as a chemoattractant for human hematopoietic progenitor cells expressing CD34 giving rise to mixed types of progenitors, and more primitive types. The chemotactic response is inhibited by pertussis toxin. Chemotaxis of CD34(+) cells in response to SDF is increased by IL-3 in vitro. SDF has been shown also to induce a transient elevation of cytoplasmic calcium in these cells.
Biological Activity: Determined by its ability to chemoattract human peripheral T cells activated with PHA and IL-2 using a concentration range of 10-40 ng/ml.
Description: Recombinant SDF-1 alpha is a disulfide-linked monomer protein consisting of 69 amino acid residues, migrates as an approximately 8 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding human Stromal Cell-Derived Factor-1 alpha was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered concentrated (1 mg/ml) solution in 20 mM phosphate buffer, pH 7.2.
Genbank: P48061
Purity: ≥97% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P48061
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Hiesinger W, et al. Trends Cardiovasc Med. 2012 Aug,22(6):139-44.
2. Felix AS, et al. Cancer Microenviron. 2010 Feb 26,3(1):49-56.