IDH3G Antibody - C-terminal region : Biotin

IDH3G Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54721_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human IDH3G

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: YMTRHNNLDLVIIREQTEGEYSSLEHEVRPQKLGEGKDEDGREVELLVSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial

Protein Size: 204

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54721_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54721_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3421
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×