IER5L Antibody - middle region : Biotin

IER5L Antibody - middle region : Biotin
Artikelnummer
AVIARP55970_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IER5L

Key Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Immediate early response gene 5-like protein

Protein Size: 404

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55970_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55970_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 389792
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×