IFIT5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFIT5

Key Reference: Niikura,T., (1997) Blood Cells Mol. Dis. 23 (3), 337-349

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon-induced protein with tetratricopeptide repeats 5

Protein Size: 482

Purification: Affinity Purified

• Artikelnummer: AVIARP54898_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54898_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 24138
• Wirt: Rabbit