IFNA7 Antibody - N-terminal region : FITC

IFNA7 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55373_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFNA7

Key Reference: Nyman,T.A., Biochem. J. 329 (PT 2), 295-302 (1998)

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon alpha-7

Protein Size: 189

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55373_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55373_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3444
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×