IL17D Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. The treatment of endothelial cells with this cytokine has been shown to stimulate the production of other cytokines including IL6, IL8 and CSF2/ GM-CSF. The increased expression of IL8 induced by this cytokine was found to be NF-kappa B-dependent.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL17D

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-17D

Protein Size: 202

Purification: Affinity Purified

• Artikelnummer: AVIARP57724_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57724_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 53342
• Wirt: Rabbit