Il1f5 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of Il1f5 remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin 1 family, member 5 (Delta) (Predicted), isoform CRA_a EMBL EDL93666.1

Protein Size: 156

Purification: Affinity Purified

• Artikelnummer: AVIARP55627_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55627_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 311783
• Wirt: Rabbit