Impa2 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Impa2 can use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. Impa2 has been implicated as the pharmacological target for lithium Li+ action in brain.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Impa2

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: GAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol monophosphatase 2

Protein Size: 290

Purification: Affinity Purified

• Artikelnummer: AVIARP58230_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58230_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 114663
• Wirt: Rabbit