INPP5B Antibody - middle region : Biotin

INPP5B Antibody - middle region : Biotin
Artikelnummer
AVIARP54772_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). INPP5B is the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus.Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). This gene encodes the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human INPP5B

Key Reference: Williams,C., J. Cell. Sci. 120 (PT 22), 3941-3951 (2007)

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Type II inositol 1,4,5-trisphosphate 5-phosphatase

Protein Size: 913

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54772_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54772_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3633
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×