INPP5F Antibody - N-terminal region : Biotin

INPP5F Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55113_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is an inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase and contains a Sac domain. The activity of this protein is specific for phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human INPP5F

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: VCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKIIPSPDDSKFLLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositide phosphatase SAC2

Protein Size: 375

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55113_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55113_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22876
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×