Interferon gamma Receptor 1 antibody

Application Note: WB: 0.1-0.5μg/ml. ICC/IF: 0.5-1μg/ml. IHC-Fr: 0.5-1μg/ml. FACS: 1-3μg/1x10⁶ cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 54

Form: Liquid

Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. [provided by RefSeq, Jul 2008]

Uniprot ID: P15260

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.

Purification: Purified by antigen-affinity chromatography

Conjugation: Unconjugated

Full Name: interferon gamma receptor 1

• Artikelnummer: GTX02780-100
• Hersteller: GeneTex
• Hersteller Artikelnummer: GTX02780-100
• Green Labware: Nein
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunofluorescence, Immunohistochemistry (frozen), Western Blotting, Flow Cytometry, Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 3459
• Wirt: Rabbit