INTS13 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C12orf11

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: VQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: integrator complex subunit 13

Protein Size: 706

Purification: Affinity Purified

• Artikelnummer: AVIARP57133_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57133_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55726
• Wirt: Rabbit