IPP Antibody - C-terminal region : FITC

IPP Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54790_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IPP is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin.The protein encoded by this gene is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin. Transcript variants have been described but their full-length nature has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IPP

Key Reference: VanHouten,J.N., (2001) Oncogene 20 (38), 5366-5372

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Actin-binding protein IPP

Protein Size: 584

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54790_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54790_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3652
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×