Itgb1 Antibody - C-terminal region : FITC

Itgb1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58832_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Itgb1 plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis.

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: PDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Integrin beta-1

Protein Size: 798

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58832_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58832_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 16412
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×