ITGB3BP Antibody - N-terminal region : HRP

ITGB3BP Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55000_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ITGB3BP

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMML

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centromere protein R

Protein Size: 216

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55000_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55000_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23421
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×