IVD Antibody - N-terminal region : FITC

IVD Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58485_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Isovaleryl-CoA dehydrogenase (IVD) is a mitochondrial matrix enzyme that catalyzes the third step in leucine catabolism. The genetic deficiency of IVD results in an accumulation of isovaleric acid, which is toxic to the central nervous system and leads to isovaleric acidemia.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human IVD

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Isovaleryl-CoA dehydrogenase, mitochondrial

Protein Size: 423

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58485_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58485_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3712
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×