English
JMJD8 Antibody - middle region : FITC
JMJD8 Antibody - middle region : FITC
Artikelnummer
AVIARP58212_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: The functions of LOC339123 remain unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC339123
Key Reference: Daniels,R.J., (2001) Hum. Mol. Genet. 10 (4), 339-352
Molecular Weight: 32kDa
Peptide Sequence: Synthetic peptide located within the following region: SFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGD
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: JmjC domain-containing protein 8
Protein Size: 285
Purification: Affinity Purified
Description of Target: The functions of LOC339123 remain unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC339123
Key Reference: Daniels,R.J., (2001) Hum. Mol. Genet. 10 (4), 339-352
Molecular Weight: 32kDa
Peptide Sequence: Synthetic peptide located within the following region: SFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGD
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: JmjC domain-containing protein 8
Protein Size: 285
Purification: Affinity Purified
| Artikelnummer | AVIARP58212_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58212_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 339123 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
