JMJD8 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The functions of LOC339123 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC339123

Key Reference: Daniels,R.J., (2001) Hum. Mol. Genet. 10 (4), 339-352

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: SFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: JmjC domain-containing protein 8

Protein Size: 285

Purification: Affinity Purified

• Artikelnummer: AVIARP58212_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58212_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 339123
• Wirt: Rabbit