KANK1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene belongs to the Kank family of proteins, which contain multiple ankyrin repeat domains. This family member functions in cytoskeleton formation by regulating actin polymerization. This gene is a candidate tumor suppressor for renal cell carcinoma. Mutations in this gene cause cerebral palsy spastic quadriplegic type 2, a central nervous system development disorder. A t(5;9) translocation results in fusion of the platelet-derived growth factor receptor beta gene (PDGFRB) on chromosome 5 with this gene in a myeloproliferative neoplasm featuring severe thrombocythemia. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 20.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human KANK1

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: STALSIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: KN motif and ankyrin repeat domain-containing protein 1

Protein Size: 330

Purification: Affinity Purified

• Artikelnummer: AVIARP55572_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55572_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23189
• Wirt: Rabbit