KCTD16 Antibody - N-terminal region : FITC

KCTD16 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57447_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD16

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BTB/POZ domain-containing protein KCTD16

Protein Size: 428

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57447_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57447_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57528
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×