KCTD21 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: KCTD21 contains 1 BTB (POZ) domain. The exact function of KCTD21 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCTD21

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: BTB/POZ domain-containing protein KCTD21

Protein Size: 260

Purification: Affinity Purified

• Artikelnummer: AVIARP54467_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54467_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 283219
• Wirt: Rabbit