KIAA0776 Antibody - middle region : Biotin

KIAA0776 Antibody - middle region : Biotin
Artikelnummer
AVIARP55228_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: KIAA0776 is an E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0776

Molecular Weight: 89kDa

Peptide Sequence: Synthetic peptide located within the following region: EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 UFM1-protein ligase 1

Protein Size: 794

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55228_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55228_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23376
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×