KIAA1189 Antibody - middle region : Biotin

KIAA1189 Antibody - middle region : Biotin
Artikelnummer
AVIARP56188_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1189

Key Reference: Brockschnieder,D., (2006) J. Neurosci. 26 (3), 757-762

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ermin

Protein Size: 297

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56188_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56188_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57471
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×