KIF5C Antibody - N-terminal region : FITC

KIF5C Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54737_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5C

Key Reference: Cho,K.I., (2007) Traffic 8 (12), 1722-1735

Molecular Weight: 109kDa

Peptide Sequence: Synthetic peptide located within the following region: TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kinesin heavy chain isoform 5C

Protein Size: 957

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54737_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54737_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3800
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×