KIFAP3 Antibody - middle region : HRP

KIFAP3 Antibody - middle region : HRP
Artikelnummer
AVIARP55128_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras; one is to stimulate their GDP/GTP exchange reactions, and the other is to inhibit their interactions with membranes. The protein encoded by this gene contains 9 'Armadillo' repeats and interacts with the smg GDS protein through these repeats. This protein, which is highly concentrated around the endoplasmic reticulum, is phosphorylated by v-src, and this phosphorylation reduces the affinity of the protein for smg GDS. It is thought that this protein serves as a linker between human chromosome-associated polypeptide (HCAP) and KIF3A/B, a kinesin superfamily protein in the nucleus, and that it plays a role in the interaction of chromosomes with an ATPase motor protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIFAP3

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Kinesin-associated protein 3

Protein Size: 792

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55128_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55128_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22920
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×