KLHL9 Antibody - middle region : FITC

KLHL9 Antibody - middle region : FITC
Artikelnummer
AVIARP57295_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KLHL9 is the substrate-specific adapter for a CUL3-based E3 ubiquitin-protein ligase complex. Within this complex, KLHL9 controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of c

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLHL9

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch-like protein 9

Protein Size: 617

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57295_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57295_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55958
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×