KLK10 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLK10

Key Reference: Kulasingam,V. (2007) Biol. Chem. 388 (10), 1113-1119

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kallikrein-10

Protein Size: 276

Purification: Affinity Purified

• Artikelnummer: AVIARP56451_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56451_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5655
• Wirt: Rabbit