KNG1 Antibody - N-terminal region : Biotin

KNG1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP59203_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kininogen-1 Ensembl ENSP00000396025

Protein Size: 391

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59203_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59203_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3827
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×