English
KPNA3 Antibody - N-terminal region : FITC
KPNA3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54674_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3 is a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KPNA2), respectively. The similarities among these proteins suggest that karyopherin alpha-3 may be involved in the nuclear transport system.The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3, encodes a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KPNA2), respectively. The similarities among these proteins suggests that karyopherin alpha-3 may be involved in the nuclear transport system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KPNA3
Key Reference: Singh,A.P., (2007) Cell 131 (3), 492-504
Molecular Weight: 58kDa
Peptide Sequence: Synthetic peptide located within the following region: AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Importin subunit alpha-3
Protein Size: 521
Purification: Affinity Purified
Subunit: alpha-3
Description of Target: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3 is a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KPNA2), respectively. The similarities among these proteins suggest that karyopherin alpha-3 may be involved in the nuclear transport system.The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3, encodes a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KPNA2), respectively. The similarities among these proteins suggests that karyopherin alpha-3 may be involved in the nuclear transport system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KPNA3
Key Reference: Singh,A.P., (2007) Cell 131 (3), 492-504
Molecular Weight: 58kDa
Peptide Sequence: Synthetic peptide located within the following region: AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Importin subunit alpha-3
Protein Size: 521
Purification: Affinity Purified
Subunit: alpha-3
| Artikelnummer | AVIARP54674_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54674_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 3839 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
