Kras Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Kras is a oncogene and member of the small GTPase superfamily.

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog EMBL AAI26087.1

Protein Size: 188

Purification: Affinity Purified

• Artikelnummer: AVIARP55409_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55409_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 24525
• Wirt: Rabbit