KRCC1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KRCC1

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: KMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lysine-rich coiled-coil protein 1

Protein Size: 259

Purification: Affinity Purified

• Artikelnummer: AVIARP56951_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56951_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51315
• Wirt: Rabbit