KRT84 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KRT84

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Keratin, type II cuticular Hb4

Protein Size: 600

Purification: Affinity Purified

• Artikelnummer: AVIARP55404_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55404_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3890
• Wirt: Rabbit