LASP1 Antibody - middle region : Biotin

LASP1 Antibody - middle region : Biotin
Artikelnummer
AVIARP54797_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.This gene encodes a member of a LIM protein subfamily which is characterized by a LIM motif and a domain of Src homology region 3. This protein functions as an actin-binding protein and possibly in cytoskeletal organization. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LASP1

Key Reference: Stone,J.L., (2007) Hum. Mol. Genet. 16 (6), 704-715

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LIM and SH3 domain protein 1

Protein Size: 261

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54797_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54797_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3927
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×