English
LCN12 Antibody - N-terminal region : FITC
LCN12 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58489_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCN12
Key Reference: Suzuki,K., Gene 339, 49-59 (2004)
Molecular Weight: 39kDa
Peptide Sequence: Synthetic peptide located within the following region: GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: LCN12 protein EMBL AAH41168.1
Protein Size: 355
Purification: Affinity Purified
Description of Target: LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCN12
Key Reference: Suzuki,K., Gene 339, 49-59 (2004)
Molecular Weight: 39kDa
Peptide Sequence: Synthetic peptide located within the following region: GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: LCN12 protein EMBL AAH41168.1
Protein Size: 355
Purification: Affinity Purified
| Artikelnummer | AVIARP58489_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58489_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 286256 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
