LDHA Antibody - middle region : Biotin

LDHA Antibody - middle region : Biotin
Artikelnummer
AVIARP54777_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LDHA

Key Reference: Listerman,I., PLoS Genet. 3 (11), E212 (2007)

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: L-lactate dehydrogenase A chain

Protein Size: 332

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54777_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54777_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 3939
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×